Packaging illustration. Appearance and supplied pack size vary by specification and batch.
Antibacterial Protein LL-37 (human)
Source-grounded material identity. Batch specifications and availability on request.
| CAS number | 154947-66-7 |
| Sequence | [LL-37, 37 aa] |
| Molecular formula | // |
| Molecular weight | // |
Purity, appearance, documentation, stock and pack sizes must be confirmed for the quoted batch. Information in the source catalog is indicative and is not a batch certificate.
Send enquiry →Material overview
Technical material listing for Antibacterial Protein LL-37 (human). CAS 154947-66-7. Contact us to confirm current specification, availability, appropriate documentation, packaging and project fit. No human-use information is provided.
Specification and documentation
We can discuss requested grade, target purity, quantity, packaging and applicable analytical documents. Batch COA and safety information are shared when available for the quoted material. No generic document is presented as a batch-specific certificate.
OEM and custom production
Peptide and lyophilized powder programs may be evaluated for custom synthesis, formulation or OEM / ODM work. Feasibility depends on the identity, intended application and destination market.