Peptide raw materials • Lab and industrial supply Enquiries: info@hytanpeptides.com
Peptide Raw MaterialRequest a Quote
Illustrative packaging visual for FOXO4-DRI

Packaging illustration. Appearance and supplied pack size vary by specification and batch.

Bulk Peptide Powder

FOXO4-DRI

Source-grounded material identity. Batch specifications and availability on request.

CAS number2460055-10-9
Sequenceltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg(all D-AA, D型Ile用D-ALLO-Ile)
Molecular formulaC228H388N86O64
Molecular weight5358.06

Purity, appearance, documentation, stock and pack sizes must be confirmed for the quoted batch. Information in the source catalog is indicative and is not a batch certificate.

Send enquiry →

Material overview

Technical material listing for FOXO4-DRI. CAS 2460055-10-9. Contact us to confirm current specification, availability, appropriate documentation, packaging and project fit. No human-use information is provided.

Specification and documentation

We can discuss requested grade, target purity, quantity, packaging and applicable analytical documents. Batch COA and safety information are shared when available for the quoted material. No generic document is presented as a batch-specific certificate.

OEM and custom production

Peptide and lyophilized powder programs may be evaluated for custom synthesis, formulation or OEM / ODM work. Feasibility depends on the identity, intended application and destination market.

Request this material

Protected by verification, a hidden spam field and request rate limits. We never publish your message.